Protein Info for Psest_1815 in Pseudomonas stutzeri RCH2

Annotation: pseudaminic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 TIGR03586: pseudaminic acid synthase" amino acids 19 to 344 (326 residues), 511.6 bits, see alignment E=4.4e-158 PF03102: NeuB" amino acids 40 to 278 (239 residues), 305 bits, see alignment E=3.8e-95 PF08666: SAF" amino acids 293 to 346 (54 residues), 35.8 bits, see alignment 9.8e-13

Best Hits

Swiss-Prot: 44% identical to PSEI_CAMJJ: Pseudaminic acid synthase (pseI) from Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 85% identity to psa:PST_3835)

MetaCyc: 44% identical to pseudaminic acid synthase (Campylobacter jejuni)
RXN-10002 [EC: 2.5.1.97]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.56 or 2.5.1.97

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK38 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Psest_1815 pseudaminic acid synthase (Pseudomonas stutzeri RCH2)
MPNIPSISIAGRRIAADEPPYIIAELSANHNGRLETALRIIEEAKKAGADAIKLQTYTAD
TITLNCDSEEFQIHGGLWGGKTLYQLYQEAHMPWDWHKPLFEHARSHDITIFSSPFDNTA
VDLLEDLNAPAYKIASFEAVDLPLIKYVASTGKPMIISTGMADAEEIQEAIDAAREGGCK
ELAILHCVSGYPAPAEDYNLRTIPDMMQRFGLVTGLSDHTLDNTTAIASVVLGASIIEKH
FTLDRNGGGPDDSFSLEPVELAALCRDSKTVWSALGKVDYGRKSSEQGNAKFRRSLYFVK
DLKAGDVITPNAIRSVRPGFGVAPKYIEKVLGKKVREGVASGMPVAFDLIY