Protein Info for Psest_1814 in Pseudomonas stutzeri RCH2

Annotation: pseudaminic acid biosynthesis N-acetyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF13302: Acetyltransf_3" amino acids 7 to 137 (131 residues), 62 bits, see alignment E=2e-20 TIGR03585: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase" amino acids 8 to 158 (151 residues), 139 bits, see alignment E=7.1e-45 PF13420: Acetyltransf_4" amino acids 12 to 155 (144 residues), 45.9 bits, see alignment E=1.2e-15 PF00583: Acetyltransf_1" amino acids 35 to 136 (102 residues), 37 bits, see alignment E=7.2e-13

Best Hits

KEGG orthology group: None (inferred from 60% identity to bpt:Bpet2306)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLU9 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Psest_1814 pseudaminic acid biosynthesis N-acetyl transferase (Pseudomonas stutzeri RCH2)
MNSQQRVRPMAHGDLMSVLAWRNHPDVRRYMYTQHEISFDEHSRWFERASQDPSRHLLMY
ESEATPMGFINIHQIAAGGIADWGFYAAPDAPKGTGKQLGQAALQYAFSVVGVHKLCAQA
LRYNERSIRFHGSLGFQQEGILRQQHFDGQHYHDVVCFGLLANEWHMNL