Protein Info for Psest_1811 in Pseudomonas stutzeri RCH2

Annotation: UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR03588: UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase" amino acids 1 to 383 (383 residues), 584.4 bits, see alignment E=4.5e-180 PF01041: DegT_DnrJ_EryC1" amino acids 8 to 381 (374 residues), 377 bits, see alignment E=5.6e-117

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_3839)

Predicted SEED Role

"Bacillosamine/Legionaminic acid biosynthesis aminotransferase PglE; 4-keto-6-deoxy-N-Acetyl-D-hexosaminyl-(Lipid carrier) aminotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKP4 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psest_1811 UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase (Pseudomonas stutzeri RCH2)
MIPYGRQDITQADIDAVVSVLQSDFLTQGPMVPRFEQSVAQHVGASHALAMNSATSALHV
ACLALGLGNGDWLWTTPITFVASANCGLYCGAQVDFVDIDPRTYNLCPQALARKLEQAER
EGKLPKVVVAVHLCGQPCDMLAIHALAQRYGFKVIEDASHAIGGKYQGEFIGNCRYSDIT
VFSFHPVKIITTAEGGMALTNDAELAARMELLRSHGITRDPAQMTHEADGPWYYQQIDLG
FNYRMTELQAALGVTQLDRLDQFVARRHQLAQRYDDLLSELPVTTPWQHPDSYSGLHLYV
IRLQLGKITKTHSQVFEALRERGIGVNLHYIPVHTQPYYQRMGFGVGDFPEAERYYAEAI
SLPMFQTMTEAQQDEVVAAVREALEA