Protein Info for PGA1_c17950 in Phaeobacter inhibens DSM 17395

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 17 to 202 (186 residues), 98.7 bits, see alignment E=3.6e-32 PF04264: YceI" amino acids 291 to 429 (139 residues), 67.3 bits, see alignment E=2.1e-22

Best Hits

Predicted SEED Role

"Cytochrome b561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZT1 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PGA1_c17950 Cytochrome B561 (Phaeobacter inhibens DSM 17395)
MSSPASSPAARHNTAQHYGSVAKGFHWLTALLMLAVFPLGYFANDLAHHIQSADFDGAQA
TLNRAALLFSLHKTLGLALFLTALLRILWALSQPKPVALHSERRAETVLAEVVHWLLYCA
LVAAPLTGWIHHAATTGFAPIWWPFGQSLPFVPKSEAVAAVFGGLHWLFVWTLALALGLH
IAGALKHEVIDRDATLRRMLPGRAPEVTAQAETPHGALPFLVALAIWGLVLAGGGAFGLY
APHSHASADTTAAHGDDHTHEVATDAAPAEALPAGGWVVEDGTLAIAIVQMGSEVRGQFD
QWQASIAFEEPNAPGPAGTVTVSVAIPSLMLGSVTDQAMGPDYFDSSTYPTAEFRAEIEK
LAEGYVADGTLRIRDQEVPLRLPFTLDLNHDTATMSGSAEVNRLDFNIGRGVQDEGSLAY
AVTIAVELTANRAP