Protein Info for Psest_1809 in Pseudomonas stutzeri RCH2

Annotation: Membrane protein involved in the export of O-antigen and teichoic acid

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 249 to 276 (28 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 388 to 408 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 23 to 264 (242 residues), 29.4 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: None (inferred from 42% identity to pap:PSPA7_1976)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLU5 at UniProt or InterPro

Protein Sequence (425 amino acids)

>Psest_1809 Membrane protein involved in the export of O-antigen and teichoic acid (Pseudomonas stutzeri RCH2)
MLMPTHNFQRLLNVALRGITLASKFLLIFFLARFLEPAELGLYGLIAATIGYALYLLGFD
FYAFTTRELIKRERSQWGGLLKGQGALTAVLYCVFLPLFCLIFVRQLLPWSLAGWFFALL
ILEHLTQELSRLLIAISEQLMASLVLFLRSGVWAVAVAGLMFIEPESRTLDFVLGAWTLG
GLSALLLGIYKVTQLKMGGWHTSVDWRWIRKGLKIAIPLLIATLAIRGVFTLDRYWFEAL
VGLETLGAYVLFMGVSNALMSFLDAGVFAFSYPGLIAAHSKQDASAFRQGLRRLLGQTLL
LTAAFAVIALLLIGPLLQWLDRPLYMAQENLFPWILLTTVLYAISMVPHYALYAQGHDRP
IIQSHVASFLAFIPATWLFSFYSPLLAVPLGLSAAFTLVLLWKSWFFFQLTPAYYRSTRV
NQTPV