Protein Info for Psest_0178 in Pseudomonas stutzeri RCH2

Annotation: Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01494: FAD_binding_3" amino acids 4 to 351 (348 residues), 103.7 bits, see alignment E=2.5e-33 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 4 to 395 (392 residues), 449.1 bits, see alignment E=6.1e-139 PF08491: SE" amino acids 261 to 377 (117 residues), 32 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 42% identical to UBII_ECOLI: 2-octaprenylphenol hydroxylase (ubiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to psa:PST_4067)

MetaCyc: 42% identical to 2-octaprenylphenol 6-hydroxylase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYLPHENOL-HYDROX-RXN [EC: 1.14.13.240]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.240

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHJ6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Psest_0178 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family (Pseudomonas stutzeri RCH2)
MQADLVIVGAGMVGSTLALALEGCGLDIVVLDASPLEVATFDPSGDFEPRVSALSAASQR
ILQRVGAWPGMAARRVSPYTDMHVWDGSGTGQIHFSAETVHAEVLGHIVENRVVQDALLE
TMQSHGQVRLLGNARVEQLLCTTDGWQLTLVDGRELRTPLVIAADGANSAIRRLAGCETR
EWDYLHQAIVTSVRCRDPHQRTAWQRFTDHGPLAFLPLERDGDRHWCSIVCSVTEAEATR
LMALDDVAFRAALGRAFEERLGEVLEADPRLCIPLRQRHAKRYVQPGLALIGDAAHTIHP
LAGQGVNLGLLDAAVLAEVLRAAIARGERVADVQVLSRFERRRMPHNLAMMAAMEGFERL
FEADPLPLRWLRNTGLKAVQALPEAKAVFVRQALGLSGDLPKLARP