Protein Info for HP15_1728 in Marinobacter adhaerens HP15

Annotation: phosphonate ABC transporter, periplasmic phosphonate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 11 to 245 (235 residues), 168.5 bits, see alignment E=2e-53 TIGR04553: putative selenate ABC transporter periplasmic binding protein" amino acids 17 to 282 (266 residues), 431.6 bits, see alignment E=1.1e-133 PF12974: Phosphonate-bd" amino acids 20 to 268 (249 residues), 217.7 bits, see alignment E=9.1e-69

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 88% identity to maq:Maqu_1446)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN43 at UniProt or InterPro

Protein Sequence (282 amino acids)

>HP15_1728 phosphonate ABC transporter, periplasmic phosphonate-binding protein (Marinobacter adhaerens HP15)
MVSSLFCFTAASATAETFVFTAIPDEDETKLVERFKGVADYLSQELDVEVRYIPVKSYAA
AVSAFRNNQVQLAWFGGLSGVQARRLVPGSEAIAQGVEDEAFQTYFIANTSTGIEPADEL
SALEDNLKDKTFTFGSKGSTSGRLMPEFYIRDVFGAQPDDFFSRVGFSGNHTRTLRLVEA
GTYQVGALNFQVWEKELADGNIDTDAVQVIWETPPYPDYQWTIRGDVNERFGDGFKERVT
EALLNLDDQALLESFPRSGFIPASNDDYEPIRKTAEEIGILD