Protein Info for PGA1_c17910 in Phaeobacter inhibens DSM 17395

Annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF00977: His_biosynth" amino acids 2 to 227 (226 residues), 181.9 bits, see alignment E=1.3e-57

Best Hits

Swiss-Prot: 70% identical to HIS41_RUEST: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 1 (hisA1) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 70% identity to sit:TM1040_1053)

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQZ4 at UniProt or InterPro

Protein Sequence (247 amino acids)

>PGA1_c17910 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase-like protein (Phaeobacter inhibens DSM 17395)
MMIYPTMELKDGRCVTLDKGRLDTAMVWHVDPVATACSFAADGAEWMHLTDFDAIEGDNR
NAGLVEEIIRTAGIPVQLGGGMRSREHVEHWIDKGAGRVVVGTLAAQDPEMVRMLTRLYP
DQIVLAVDVWEGQVMTDGWRQAGSFTPEAFIEAFADCPFAGIIITDIESDMSDVEAQLGL
IAGLAEKARTPVIASGVVRTADDVARLKYIGSVSGTLVGRALFRKTLTLAEALEEAAPSR
EPVAEFR