Protein Info for Psest_1798 in Pseudomonas stutzeri RCH2

Annotation: conserved hypothetical protein, PP_1857 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF10093: EarP" amino acids 7 to 375 (369 residues), 519.8 bits, see alignment E=2.1e-160 TIGR03837: conserved hypothetical protein, PP_1857 family" amino acids 7 to 375 (369 residues), 520.5 bits, see alignment E=1.3e-160

Best Hits

KEGG orthology group: None (inferred from 83% identity to psa:PST_2513)

Predicted SEED Role

"FIG00956413: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLY7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Psest_1798 conserved hypothetical protein, PP_1857 family (Pseudomonas stutzeri RCH2)
MSVKAKWDIFCAVVDNFGDIGVTWRLARQLVAEHGQPVRLWVDDLETFARLCPAASAHDE
QQTLDGVEVRYWPKKWPGAEPADVVIEAFACNLPQAYINAMAASSRRVLWLNLEYLSAED
WIIGCHALPSLQANGLQKYFFFPGFEADTGGLIRESDLMQRRARFQADPLQQAEFLASLG
VERQPEARLLSLFAYENPAVAGWLDALAGDTRVNQLLVPEGRVLGDVAAWLGVPNVQAGD
HHQRGSLQISIVPFMTQDEYDLLLWSCDFNAVRGEESFIRAQWAGRPLVWHIYPQEDDAH
WDKLNAFLDLYAHGSPPAVEEALRGFWRAWNAGEGAGEAWTALLRQYPALLERAEGWTHE
QVVNGDLAGKLVFFYADWFGSVHG