Protein Info for HP15_1718 in Marinobacter adhaerens HP15

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 23 to 616 (594 residues), 816 bits, see alignment E=1.9e-249 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 24 to 473 (450 residues), 530.7 bits, see alignment E=3.3e-163 PF00270: DEAD" amino acids 36 to 199 (164 residues), 86.8 bits, see alignment E=3.6e-28 PF00271: Helicase_C" amino acids 234 to 341 (108 residues), 71.4 bits, see alignment E=1.8e-23 PF16124: RecQ_Zn_bind" amino acids 353 to 415 (63 residues), 77.1 bits, see alignment E=3.5e-25 PF09382: RQC" amino acids 417 to 527 (111 residues), 142 bits, see alignment E=1.8e-45 PF00570: HRDC" amino acids 553 to 616 (64 residues), 77.3 bits, see alignment E=1.7e-25

Best Hits

Swiss-Prot: 50% identical to RECQ_ECOLI: ATP-dependent DNA helicase RecQ (recQ) from Escherichia coli (strain K12)

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 87% identity to maq:Maqu_1438)

MetaCyc: 50% identical to ATP-dependent DNA helicase RecQ (Escherichia coli K-12 substr. MG1655)
RXN-11135 [EC: 5.6.2.4]

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12 or 5.6.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN33 at UniProt or InterPro

Protein Sequence (622 amino acids)

>HP15_1718 ATP-dependent DNA helicase RecQ (Marinobacter adhaerens HP15)
MYLDQDFEQLSTERPTTSGRDPEQVLHEVFGYESFRPLQGDIIREVSEGRDALVLMPTGG
GKSLCYQVPALVRSGTAIVISPLIALMQDQVAALKELGVRAAFLNSTMDFEQARATEYAL
MTGELDLLYCAPERLIQPRTIELLHDASISLFAIDEAHCVSQWGHDFRSDYLQLSMLAEQ
FPGVPRIALTATADERTRKEIAERLSLTEARHFVSGFDRPNIQYRIAPKINANKQLLDFI
KAEHEGDCGIVYCLSRNKVDATAKTLAQKGYTALPYHAGLSSEQRAHHQERFLREDGVII
VATIAFGMGIDKPDVRFVAHLDLPKSLEAYYQETGRAGRDGKPSTAWMVYGLQDVIKLRQ
MLESSQGNDHFKRVERQKLDAMLGLCEVTSCRRQVLLRYFGDELEQPCGNCDTCLNPPDT
WDGTVAVQKALSCVFRTGQRFGVTYLIDVLRGSENERILQSGHHQVSTYGIGTELSANEW
KSVYRQLVANGYLRADPEGYGALQLTEQCRPLLKGRQTIELRKDPEIKKTTGRANGGRSG
SPVSEQITDKAGWEALRACRKELADKQGVPPYVIFHDTTLFGMLERKPRTLDELAEVSGV
GAAKLEKYGEIFLQTIAGLEQA