Protein Info for Psest_1789 in Pseudomonas stutzeri RCH2

Annotation: Zn-dependent hydrolases, including glyoxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF00753: Lactamase_B" amino acids 13 to 204 (192 residues), 75.6 bits, see alignment E=2.7e-25

Best Hits

Swiss-Prot: 64% identical to Y2304_BURP1: Probable metallo-hydrolase BURPS1710b_2304 (BURPS1710b_2304) from Burkholderia pseudomallei (strain 1710b)

KEGG orthology group: None (inferred from 91% identity to psa:PST_2522)

Predicted SEED Role

"SoxH protein, homolog" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK11 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psest_1789 Zn-dependent hydrolases, including glyoxylases (Pseudomonas stutzeri RCH2)
MNAHVEAFFDPATFTYSYVVSDPVTQQCAVIDSVLDYDPASGRTSHATAERLVDYVRAQG
LTVQWLLETHVHADHLSAAPYLKQQLGGRLAIGDRITVVQDTFGKLFNAGSEFATDGRQF
DHLFHDGDTFQVGNIQAHAIHTPGHTPACMTYVIGDAAFVGDTLFMPDYGTARCDFPGGD
ARTLYQSIQKLFTLPDSTRVFMCHDYKAPGREEFLYETTIAAERELNVHVHAGITEEEFV
AMRTARDATLGMPTLILPSVQINMRGGELPEPESNGTRYLKIPLDVL