Protein Info for Psest_1776 in Pseudomonas stutzeri RCH2

Annotation: Glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF02798: GST_N" amino acids 1 to 72 (72 residues), 49.5 bits, see alignment E=1.3e-16 PF13417: GST_N_3" amino acids 6 to 78 (73 residues), 82.3 bits, see alignment E=7.7e-27 PF13409: GST_N_2" amino acids 11 to 74 (64 residues), 73.7 bits, see alignment E=4.6e-24 PF00043: GST_C" amino acids 125 to 200 (76 residues), 37.3 bits, see alignment E=8.1e-13 PF14497: GST_C_3" amino acids 129 to 204 (76 residues), 51.3 bits, see alignment E=3.6e-17 PF13410: GST_C_2" amino acids 129 to 195 (67 residues), 40.2 bits, see alignment E=9.2e-14

Best Hits

KEGG orthology group: None (inferred from 82% identity to psa:PST_2533)

Predicted SEED Role

"Glutathione S-transferase family protein" in subsystem Glutathione: Non-redox reactions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLR1 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psest_1776 Glutathione S-transferase (Pseudomonas stutzeri RCH2)
MSMTVFGVPLSPFVRKVRLCLLEKGLEYRLETVMPFTPPQWYLEINPLGRIPALKDGDCT
LADSSVICQYLEETYPETAALYGKNAQERGRVRWLEKYADYELAPLTTFTVFRNRILKPT
SGHPCNEEAVKAAMQEKLPPHFDYLEKQLNQQQFFVGDSLSMADIAITCQLINMAHGGEQ
LDAQRWPNLAAHHARMLELPSVASLLPDEQRMNAKLKEMGKPVTA