Protein Info for PGA1_c17550 in Phaeobacter inhibens DSM 17395

Annotation: pyruvate dehydrogenase E1 component subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR03182: pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit" amino acids 15 to 329 (315 residues), 518.9 bits, see alignment E=1.8e-160 PF00676: E1_dh" amino acids 23 to 320 (298 residues), 348.1 bits, see alignment E=5.2e-108 PF02775: TPP_enzyme_C" amino acids 114 to 243 (130 residues), 26.9 bits, see alignment E=5.6e-10 PF13292: DXP_synthase_N" amino acids 117 to 191 (75 residues), 22.3 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 67% identical to ODPA_RHIME: Pyruvate dehydrogenase E1 component subunit alpha (pdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00161, pyruvate dehydrogenase E1 component subunit alpha [EC: 1.2.4.1] (inferred from 94% identity to sit:TM1040_1079)

MetaCyc: 53% identical to pyruvate dehydrogenase E1 component alpha subunit (somatic) (Homo sapiens)

Predicted SEED Role

"Pyruvate dehydrogenase E1 component alpha subunit (EC 1.2.4.1)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.4.1

Use Curated BLAST to search for 1.2.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZP9 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PGA1_c17550 pyruvate dehydrogenase E1 component subunit alpha (Phaeobacter inhibens DSM 17395)
MAARKSVKKPNVSADELLEYYREMLLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVVGL
EAAAEDGDKRVTSYRDHGHMLACGMDPSGVMAELTGREGGYSKGKGGSMHMFSKEKHFYG
GHGIVGAQVPLGAGLAFSDKYKGNDRVTFAYFGDGAANQGQVYETYNMAQLWDLPVVFVI
ENNQYAMGTSVQRSTKSPALWKRGEAYGIKGEEVDGMDVLAVKEAGERAVAHCRAGKGPY
ILEVKTYRYRGHSMSDPAKYRTREEVQKMREERDPIEQVRDMLLTGKHATEDDLKAIDKE
IKDIVNKSADFSKESPEPALEELWTDIYADDLPQETA