Protein Info for PGA1_c17530 in Phaeobacter inhibens DSM 17395

Annotation: phosphoglycerate kinase Pgk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 80% identical to PGK_RUEST: Phosphoglycerate kinase (pgk) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00927, phosphoglycerate kinase [EC: 2.7.2.3] (inferred from 80% identity to sit:TM1040_1084)

MetaCyc: 50% identical to plastidic 3-phosphoglycerate kinase (Spinacia oleracea)
Phosphoglycerate kinase. [EC: 2.7.2.3]

Predicted SEED Role

"Phosphoglycerate kinase (EC 2.7.2.3)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 2.7.2.3)

MetaCyc Pathways

gluconeogenesis I (12/13 steps found)
superpathway of glucose and xylose degradation (14/17 steps found)
superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
Entner-Doudoroff pathway I (8/9 steps found)
formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
Bifidobacterium shunt (12/15 steps found)
superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
glycolysis II (from fructose 6-phosphate) (9/11 steps found)
glycolysis III (from glucose) (9/11 steps found)
Calvin-Benson-Bassham cycle (10/13 steps found)
glycolysis I (from glucose 6-phosphate) (10/13 steps found)
sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
gluconeogenesis III (9/12 steps found)
homolactic fermentation (9/12 steps found)
hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
superpathway of anaerobic sucrose degradation (14/19 steps found)
heterolactic fermentation (13/18 steps found)
glycolysis IV (7/10 steps found)
1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
superpathway of N-acetylneuraminate degradation (15/22 steps found)
glycolysis VI (from fructose) (7/11 steps found)
ethene biosynthesis V (engineered) (17/25 steps found)
oxygenic photosynthesis (11/17 steps found)
superpathway of hexitol degradation (bacteria) (11/18 steps found)
glycerol degradation to butanol (9/16 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EMG0 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PGA1_c17530 phosphoglycerate kinase Pgk (Phaeobacter inhibens DSM 17395)
MGWNALDTMDLAGKRVLVRVDINVPVEDGRVTDDTRIQRVAPTIKDILAAGGTPILLAHF
GRPKGKVVAEMSLRPLVPALEAAFGAPVTFAADCRGPAAEAAVQGLPAGGVLLLENTRFH
AGEEKNDTDLAAEMAKLGDIYCNDAFSAAHRAHASTEALARLLPACAGRLMQAELTALET
ALGQPQRPVTAVVGGAKVSTKLELLGNLVGKVDNLVIGGGMANTFLAAQGIDVGKSLCEH
DMADTAREILSKAEDQGCKIILPVDVVVAREFKAGADNETVAADACPADAMILDAGPQTV
AAVADTLSTSKTLIWNGPMGAFEIAPFDAATNAAAQQAASLTKSGALVSVAGGGDTVAAL
NQAGAAADFTYISTAGGAFLEWMEGKTLPGVAALEG