Protein Info for HP15_1688 in Marinobacter adhaerens HP15

Annotation: iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 331 to 350 (20 residues), see Phobius details TIGR02745: cytochrome c oxidase accessory protein CcoG" amino acids 32 to 459 (428 residues), 536.6 bits, see alignment E=2.5e-165 PF13746: Fer4_18" amino acids 210 to 316 (107 residues), 141.6 bits, see alignment E=3.6e-45 PF13534: Fer4_17" amino acids 214 to 278 (65 residues), 22.6 bits, see alignment E=3.6e-08 PF13187: Fer4_9" amino acids 215 to 276 (62 residues), 27.4 bits, see alignment E=8.2e-10 PF11614: FixG_C" amino acids 346 to 460 (115 residues), 88.3 bits, see alignment E=1.3e-28

Best Hits

KEGG orthology group: None (inferred from 62% identity to hch:HCH_03522)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoG, involved in Cu oxidation" in subsystem Biogenesis of cbb3-type cytochrome c oxidases or Terminal cytochrome C oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PN03 at UniProt or InterPro

Protein Sequence (463 amino acids)

>HP15_1688 iron-sulfur cluster-binding protein (Marinobacter adhaerens HP15)
MSQNIPLRNIDTVPDRPTLMDKIHTRSFKGYFRRLRILGGALLFALYFGTVWLTSGDRQA
VLWDLSEKQFHIFGSTFWPQDLVLLSAILIICAVGLFFLTVLAGRVWCGYTCPQSVWMWI
FMWAEKVTEGDRNQRIKLDQAPMSIAKFFKRARKHTLWLLISLATAVTFVGYFTPIRELL
PNLITMDIGATALFWVFFFTVATYTNAGWLREKVCLHMCPYGRFQSSMLDQDSLVITYDA
ARGESRGPRKKGADYKSEGLGDCIDCQMCVQVCPTGIDIRDGLQMECIACAACIDACDSV
MEKMAYGTGLIRYTSERALNGGGLRIVRPRMLGYAVVLLAMISALSWAFVSRPMLTLDIE
KDRGLFRYNTQGHIENSYVLKILNKSQHSQSYNIGVSGVDGLQLSSAAPVSVGARERVEL
PITVSVAPESLETEVSAINFHLQSVKDPALKLVANSKFVGTIQ