Protein Info for PGA1_c17410 in Phaeobacter inhibens DSM 17395

Annotation: MFS type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 200 to 226 (27 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 181 (171 residues), 41.8 bits, see alignment E=6.9e-15 amino acids 204 to 383 (180 residues), 71.4 bits, see alignment E=6.7e-24 PF00083: Sugar_tr" amino acids 39 to 156 (118 residues), 24.9 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: None (inferred from 76% identity to sil:SPO2225)

Predicted SEED Role

"Transporter, Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQU6 at UniProt or InterPro

Protein Sequence (424 amino acids)

>PGA1_c17410 MFS type transporter (Phaeobacter inhibens DSM 17395)
MWQVLSSAWALLLGMGMLMIGNGLQGTLLGVRGDIEGFSTLQMSFVMSAYFVGFLGGSRL
APEMIRRVGHVRVFAALASFISAVMILYPAVTNPVAWMLLRVVIGFCFSGVYVTAESWLN
NASDNANRGKALSLYMIVQMIGIVSAQALLLVGDPSGYETFVIASVVVSVSFAPILLSIS
PTPAFDRTKPMSLRQLMDASPLGCVGMFLLGGVFSAQFGMSAVYAASAGLSLTQISIFVA
TFYVGAVVMQYPLGWMSDRMDRRILILFGAAVAGAAAIGAMILGTDFNFLLIAAFLIGGM
TNPLYSLLIAHTNDYLDYDDMPAASGGLVFINGLGAVAGPLITGWMMGDSVFGAPGFFLF
MAVLLLLLAVYAGYRTTQRPAIPTDETGIMSPMAPTGSPVVVEFAQEYAIETDIEEQEAA
AETS