Protein Info for PGA1_c17360 in Phaeobacter inhibens DSM 17395

Annotation: 3-hydroxyisobutyrate dehydrogenase MmsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF03446: NAD_binding_2" amino acids 2 to 153 (152 residues), 145.9 bits, see alignment E=2.3e-46 PF03807: F420_oxidored" amino acids 3 to 86 (84 residues), 28.8 bits, see alignment E=3.2e-10 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 5 to 281 (277 residues), 385.7 bits, see alignment E=7e-120 PF14833: NAD_binding_11" amino acids 156 to 281 (126 residues), 128.9 bits, see alignment E=2.6e-41

Best Hits

Swiss-Prot: 46% identical to MMSB_MYCTO: Probable 3-hydroxyisobutyrate dehydrogenase (mmsB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 85% identity to sit:TM1040_1101)

MetaCyc: 47% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

"3-hydroxyisobutyrate dehydrogenase (EC 1.1.1.31)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQU1 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PGA1_c17360 3-hydroxyisobutyrate dehydrogenase MmsB (Phaeobacter inhibens DSM 17395)
MNIGFIGLGNMGGPMAANLAKAGHDVTGFDMADVSIEGVTMAASAAEAATDAEVVITMLP
NGQILRAVADDVIPAMSAGATLVDCSTVDVDSARAVADQAGSANLMFVDAPVSGGIGGAS
GGTLTFMAGGSAAAFAAAEPLFDIMGQKAVHCGEAGAGQAAKICNNMILGITMIGTCEAF
ALADKLGLDRQKMFDVVSTSSGYSWSMNAYCPAPGVGPQSPADNDYQPGFAAELMLKDLR
LAQQAAHSADADTPMGALAQALYSMFVEDEGGAGKDFSAMLPRFEARSRHD