Protein Info for PGA1_c17310 in Phaeobacter inhibens DSM 17395

Annotation: putative fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 97 to 113 (17 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 60 to 313 (254 residues), 125.6 bits, see alignment E=1.5e-40

Best Hits

KEGG orthology group: K10255, omega-6 fatty acid desaturase (delta-12 desaturase) [EC: 1.14.19.-] (inferred from 64% identity to rde:RD1_0987)

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.-

Use Curated BLAST to search for 1.14.-.- or 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQT4 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c17310 putative fatty acid desaturase (Phaeobacter inhibens DSM 17395)
MSQKQNGPQTAEKTARDWVKILAQYREPNMLRSLFELTVTVVPFVLLWALAWWSLSVSYW
LTLGLSVLIAAFLLRLFTIQHDCGHGSFFSNRRLSDWVGRIIGVLTLTPYDVWRRTHSIH
HSTHGNLGKRGMGDIHTMTVAEYRAESRWGRLMYRLYRHPITLFAIGPGYLFFLQNRIPY
GLMGQARYWISAMGTNLTIVIALAAIWYFGGLMPLLLIFVPATLLAATAGLWLFYVQHQF
ETTQWEQEDDWQLHDAALHGSSHYVLPPVLQWISANIGIHHVHHLYSRIPFYRLPQVLRD
HAELAEGNRMTIRESLANARLHLWDENSKRLLSFAQVRQLYG