Protein Info for Psest_1737 in Pseudomonas stutzeri RCH2

Annotation: flagellar biosynthesis protein FlhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 240 to 266 (27 residues), see Phobius details amino acids 286 to 304 (19 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 20 to 703 (684 residues), 866.4 bits, see alignment E=6.9e-265 PF00771: FHIPEP" amino acids 31 to 695 (665 residues), 894 bits, see alignment E=3.3e-273

Best Hits

Swiss-Prot: 55% identical to FLHA_ECOLI: Flagellar biosynthesis protein FlhA (flhA) from Escherichia coli (strain K12)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 97% identity to psa:PST_2572)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJV6 at UniProt or InterPro

Protein Sequence (706 amino acids)

>Psest_1737 flagellar biosynthesis protein FlhA (Pseudomonas stutzeri RCH2)
MDRTQLINIRNGLTGAGRGNLGVPLLLLVMMGMMMLSVPPFLLDLLFTFNIALSIVVLLV
SVYALRPLDFAVFPTILLVATLMRLALNVASTRVVLINGHEGGSAAGHVIEAFGNVVIGG
NYVVGIVVFAILMIINFVVVTKGAGRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEA
KKRRVEVSSEADFYGSMDGASKFVRGDAIAGLLILFINLIGGVGIGMAQHGMSFSEAGQV
YALLTIGDGLVAQIPSLLLSTAAAIMVTRVTSSEDMGQQVQRQMFASPKALAVAAAIMIA
MGLVPGMPHLSFLGLGAAAAAGAYWIWHRKKQVEKKAEQEVQKQQEMLPAQRSAETKELG
WDDVTPVDMVGLEVGYRLIPLVDRNQGGQLLARIKGVRKKLSQDLGFLMPSVHIRDNLDL
LPNAYRLTLMGVSLAEAEVYPDRELAINPGQVFGPLNGISARDPAFGLEAVWIEASQRDQ
AQSLGYTVVDASTVVATHLNQVLHKHAHELLGHEEVQQLLQLLAKSSPKLAEELVPGMVS
LSTLLKVLQALLQEQVPVRDIRTIAEAIANVAAKSQDPAAMVAAVRVALSRAIVQNVVGL
EPELPVITLEPRLEQILLNSLQKAGQGSEDGILLEPGMAEKLQRSLVEAAQRQEMLGKPA
VLLVAGPVRAMLSRFARLAVPNIHVLAYQEIPDNKQVTIVSTVGQN