Protein Info for PGA1_c17230 in Phaeobacter inhibens DSM 17395

Annotation: transketolase TktA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13292: DXP_synthase_N
  • amino acids 16 to 200 (185 residues), 23.2 bits, E=1.4e-08
• TIGR00232: transketolase
  • amino acids 16 to 672 (657 residues), 781.5 bits, E=3.2e-239
• PF00456: Transketolase_N
  • amino acids 17 to 325 (309 residues), 387.8 bits, E=1.4e-119
• PF02775: TPP_enzyme_C
  • amino acids 111 to 247 (137 residues), 23.7 bits, E=1.3e-08
• PF00676: E1_dh
  • amino acids 121 to 275 (155 residues), 37.2 bits, E=5.9e-13
• PF02779: Transket_pyr
  • amino acids 356 to 527 (172 residues), 186.8 bits, E=1e-58
• PF22613: Transketolase_C_1
  • amino acids 542 to 660 (119 residues), 130 bits, E=1.6e-41
• PF02780: Transketolase_C
  • amino acids 544 to 663 (120 residues), 46.9 bits, E=8.9e-16

Best Hits

Swiss-Prot: 65% identical to TKT_RHOCB: Transketolase (tktA) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 87% identity to sit:TM1040_1113)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• pentose phosphate pathway (7/8 steps found)
• Bifidobacterium shunt (12/15 steps found)
• pentose phosphate pathway (partial) (3/3 steps found)
• Rubisco shunt (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of ansamycins
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

See I7EME3 at UniProt or InterPro

Protein Sequence (673 amino acids)

>PGA1_c17230 transketolase TktA (Phaeobacter inhibens DSM 17395)
MDLTALRNANPEHWTKAAAIRALTLDAVAAANSGHSGMPIGMADVATVLFEKHMKFDVAN
PQWPDRDRFILSAGHGSMLIYSLLYLMGDAQVTLDQVKNFRQMGALTAGHPENFLIDAVE
TTTGPLGQGIANAVGFAMAEEMQRAHYGRKLVDHHTYVIAGDGCLMEGISQEAIGLAGRH
SLGKLIVFWDNNNITIDGTVELSDRTNQVQRFKASGWQVIEIDGHDPKAIDEAIEAAKKS
KKPSMIACKTHIALGHAAQDTSKGHGALTDADQMRDAKAAYGWTTGPFEVPADVKSQWEA
IGQRGAAEREAWESRFAEASQQKQDRFNRAYALDAPKKLSATIKALKKQVSETQPKVATR
KSSEMALEVINPIMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMASA
MNGMALHGGMRPYGGTFFCFTDYARPAMRLAALMKIPTVFVMTHDSIGVGEDGPTHQPVE
HLAICRATPNTYVFRPADTVETAEAWEIALTSKDTPSVMTLTRQNLPTVRTEHKLSNLTA
KGGYVLAEAEGKRQVILIATGSEVSVAMDAKAKLEADGIGTRVVSMPCMELFAEQDEAYR
RKVLPAGPVRVGIEAAMRAGGWDRLLMGERGQEKKAAFVGMDSFGASAPAGELFEKFGIT
ADHTVAKVKELLG