Protein Info for PGA1_c17230 in Phaeobacter inhibens DSM 17395

Annotation: transketolase TktA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 transmembrane" amino acids 69 to 87 (19 residues), see Phobius details PF13292: DXP_synthase_N" amino acids 16 to 200 (185 residues), 23.2 bits, see alignment E=1.4e-08 TIGR00232: transketolase" amino acids 16 to 672 (657 residues), 781.5 bits, see alignment E=3.2e-239 PF00456: Transketolase_N" amino acids 17 to 325 (309 residues), 387.8 bits, see alignment E=1.4e-119 PF02775: TPP_enzyme_C" amino acids 111 to 247 (137 residues), 23.7 bits, see alignment E=1.3e-08 PF00676: E1_dh" amino acids 121 to 275 (155 residues), 37.2 bits, see alignment E=5.9e-13 PF02779: Transket_pyr" amino acids 356 to 527 (172 residues), 186.8 bits, see alignment E=1e-58 PF22613: Transketolase_C_1" amino acids 542 to 660 (119 residues), 130 bits, see alignment E=1.6e-41 PF02780: Transketolase_C" amino acids 544 to 663 (120 residues), 46.9 bits, see alignment E=8.9e-16

Best Hits

Swiss-Prot: 65% identical to TKT_RHOCB: Transketolase (tktA) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 87% identity to sit:TM1040_1113)

Predicted SEED Role

"Transketolase (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EME3 at UniProt or InterPro

Protein Sequence (673 amino acids)

>PGA1_c17230 transketolase TktA (Phaeobacter inhibens DSM 17395)
MDLTALRNANPEHWTKAAAIRALTLDAVAAANSGHSGMPIGMADVATVLFEKHMKFDVAN
PQWPDRDRFILSAGHGSMLIYSLLYLMGDAQVTLDQVKNFRQMGALTAGHPENFLIDAVE
TTTGPLGQGIANAVGFAMAEEMQRAHYGRKLVDHHTYVIAGDGCLMEGISQEAIGLAGRH
SLGKLIVFWDNNNITIDGTVELSDRTNQVQRFKASGWQVIEIDGHDPKAIDEAIEAAKKS
KKPSMIACKTHIALGHAAQDTSKGHGALTDADQMRDAKAAYGWTTGPFEVPADVKSQWEA
IGQRGAAEREAWESRFAEASQQKQDRFNRAYALDAPKKLSATIKALKKQVSETQPKVATR
KSSEMALEVINPIMPETVGGSADLTGSNNTKTGDLGVFDTDNRKGRYVYWGIREHGMASA
MNGMALHGGMRPYGGTFFCFTDYARPAMRLAALMKIPTVFVMTHDSIGVGEDGPTHQPVE
HLAICRATPNTYVFRPADTVETAEAWEIALTSKDTPSVMTLTRQNLPTVRTEHKLSNLTA
KGGYVLAEAEGKRQVILIATGSEVSVAMDAKAKLEADGIGTRVVSMPCMELFAEQDEAYR
RKVLPAGPVRVGIEAAMRAGGWDRLLMGERGQEKKAAFVGMDSFGASAPAGELFEKFGIT
ADHTVAKVKELLG