Protein Info for Psest_1734 in Pseudomonas stutzeri RCH2

Annotation: flagellar biosynthetic protein FliR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 100 (28 residues), see Phobius details amino acids 121 to 152 (32 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 237 to 254 (18 residues), see Phobius details PF01311: Bac_export_1" amino acids 15 to 243 (229 residues), 222.5 bits, see alignment E=3e-70 TIGR01400: flagellar biosynthetic protein FliR" amino acids 15 to 254 (240 residues), 253.8 bits, see alignment E=9.1e-80

Best Hits

Swiss-Prot: 42% identical to FLIR_SALTY: Flagellar biosynthetic protein FliR (fliR) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02421, flagellar biosynthetic protein FliR (inferred from 98% identity to psa:PST_2575)

Predicted SEED Role

"Flagellar biosynthesis protein FliR" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U3GKG7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Psest_1734 flagellar biosynthetic protein FliR (Pseudomonas stutzeri RCH2)
MLELSNAQIGGWVGQFLLPLFRIAALLMSMPIIGTQLVPVRVRLYLALAIALVLVPTLPP
MPVVESLSLASLLLIAEQLLIGVMLGFVLQLFFHVFIVSGQMLAMQMGLGFASMVDPANG
ISVPVLGQFFNMLVILLFLSVNGHLVVLEILAESFVTLPVGGGLSTNHFWEVAGKLGWVL
GAGLLLVLPAITALLVVNLAFGLMTRAAPQLNIFSIGFPLTLVLGLIIVWIGMADIFAQY
QIFVSEALLMLRELAGAR