Protein Info for Psest_1732 in Pseudomonas stutzeri RCH2

Annotation: flagellar biosynthetic protein FliP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 56 to 86 (31 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details TIGR01103: flagellar biosynthetic protein FliP" amino acids 59 to 255 (197 residues), 292.7 bits, see alignment E=6.9e-92 PF00813: FliP" amino acids 59 to 251 (193 residues), 277.1 bits, see alignment E=4.3e-87

Best Hits

Swiss-Prot: 87% identical to FLIP_PSEAE: Flagellar biosynthetic protein FliP (fliP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02419, flagellar biosynthetic protein FliP (inferred from 86% identity to pfv:Psefu_1935)

Predicted SEED Role

"Flagellar biosynthesis protein FliP" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U3GM58 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Psest_1732 flagellar biosynthetic protein FliP (Pseudomonas stutzeri RCH2)
MLRILLVAVLMLCGPLAMAQEPSGILAQGNNPLSIPAITLTTDAEGQQEYSVSLQILLIM
TALSFIPAFVMLMTSFTRIIIVFSILRQALGLQQTPSNQILIGLTLFLTLFIMAPVFDRI
NQDALQPYLSEQIPAQEAISRAEVPLKNFMLAQTRESDLELFVRLSRRTDIASPEAAPMT
ILVPAFVTSELKTAFQIGFMIFIPFLIIDMVVASVLMAMGMMMLSPLIISLPFKIMLFVL
VDGWGLIIGTLAGSFGTL