Protein Info for Psest_1725 in Pseudomonas stutzeri RCH2

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 PF00072: Response_reg" amino acids 7 to 118 (112 residues), 91.1 bits, see alignment E=7.8e-30 PF07228: SpoIIE" amino acids 192 to 377 (186 residues), 151.8 bits, see alignment E=3.5e-48 PF13581: HATPase_c_2" amino acids 438 to 559 (122 residues), 35 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_2584)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit / Serine-protein kinase RsbW (EC 2.7.11.1)" in subsystem SigmaB stress responce regulation (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLR8 at UniProt or InterPro

Protein Sequence (563 amino acids)

>Psest_1725 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Pseudomonas stutzeri RCH2)
MPMRLSILIAEDSPVDRMLLSTIVTRQGHRVLTAADGQEAVELFQQERPQLVLMDALMPV
MDGFEAARRIKQLAGDELVPIIFLTSLTENEALVQCLEAGGDDFIAKPYNPIILEAKIQA
MHRLRRLQATVLEQRDLIARRNQQLLAEHRAAKAIFDKVAHAGCLSAPNIRYRQSPQALF
NGDLLLAAQAPAGQMFVLLGDFTGHGLPAAIGAMPLAETFYGMAAKGYSGADILREMNAK
LKQILPVEMFCCAMLLDINPKQGSLRVWNGGLPDGYLIGANGQRTALVSRHLPLGVVSAA
ALDDKFEHYPLAPGDRLLLLSDGVVESRNADDELFGEQRLLAALTANRDPAQLFDEIEQA
LLDFHGQQHDDLSLVEVVVTDEAMAMPLVAPATAHRSRPMDWSVRLELRAESLRSGNPLP
MLLQLLLQVNQLRPRAGAIYAVLGELYSNALEHGVLGLDSALKRDAEGFQRYYDLRQQRL
QALAEGYVHLELAIRTDSQGGRLRISIGDSGAGFDVTRALQVQLGSGRFSGRGLHLVRQL
SDGFDWQSDGRGLSVEFVWRPDA