Protein Info for Psest_1723 in Pseudomonas stutzeri RCH2

Annotation: flagellar export protein FliJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR02473: flagellar export protein FliJ" amino acids 7 to 144 (138 residues), 112.1 bits, see alignment E=1.4e-36 PF02050: FliJ" amino acids 8 to 148 (141 residues), 143.6 bits, see alignment E=2.4e-46

Best Hits

KEGG orthology group: K02413, flagellar FliJ protein (inferred from 95% identity to psa:PST_2586)

Predicted SEED Role

"Flagellar protein FliJ" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKF5 at UniProt or InterPro

Protein Sequence (150 amino acids)

>Psest_1723 flagellar export protein FliJ (Pseudomonas stutzeri RCH2)
MAASRAARLAPVIEMAERAERDAARLLGQAQTQLAQAETKLAELDQYFRDYQQQWMQQGS
QGVSGQWLMNYQRFLSQLESAIGQQQRSVNWYRDNLLKVRQQWHQKHARLEGLSKLIESY
QREARIAADKREQKLLDEFAQRLAGRARDL