Protein Info for Psest_1720 in Pseudomonas stutzeri RCH2

Annotation: flagellar motor switch protein FliG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF14842: FliG_N" amino acids 9 to 110 (102 residues), 117.4 bits, see alignment E=8.7e-38 TIGR00207: flagellar motor switch protein FliG" amino acids 9 to 337 (329 residues), 337.6 bits, see alignment E=4.6e-105 PF14841: FliG_M" amino acids 120 to 193 (74 residues), 83.2 bits, see alignment E=2.5e-27 PF01706: FliG_C" amino acids 223 to 329 (107 residues), 140.8 bits, see alignment E=3.8e-45

Best Hits

Swiss-Prot: 87% identical to FLIG_PSEAE: Flagellar motor switch protein FliG (fliG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02410, flagellar motor switch protein FliG (inferred from 99% identity to psa:PST_2589)

Predicted SEED Role

"Flagellar motor switch protein FliG" in subsystem Bacterial Chemotaxis or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLR3 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Psest_1720 flagellar motor switch protein FliG (Pseudomonas stutzeri RCH2)
MNDNRLPAKLNKVDKAAILLLSLGETDAAQVLRHLGPKEVQRVGTAMAQMRNVQKTQIEQ
VMSEFVEIVGDQTSLGVGSDGYIRKMLTQALGEDKAGGLIDRILLGGNTSGLDSLKWMEP
RAVADVIRYEHPQIQAIVVAYLDPDQAGEVLSHFDHKVRLDIVLRVSSLNTVQPAALKEL
NLILEKQFSGSTNTSRASLGGVKRAADIMNYLDSSIEGQLMDAIRDVDEDLSSQIEDLMF
VFDNLAEVDDRGIQVLLREVSSDVLVMALKGADDGIKEKVFKNMSKRAGELLRDDLEAKG
PVRVSDVENAQKEILTIARRMAEAGEIVLGSKGGEEMI