Protein Info for Psest_1716 in Pseudomonas stutzeri RCH2

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 200 (193 residues), 201.6 bits, see alignment E=2.3e-63 PF08659: KR" amino acids 10 to 163 (154 residues), 44.5 bits, see alignment E=4.2e-15 PF23441: SDR" amino acids 11 to 250 (240 residues), 36.3 bits, see alignment E=1e-12 PF13561: adh_short_C2" amino acids 14 to 251 (238 residues), 243.8 bits, see alignment E=4.9e-76

Best Hits

Swiss-Prot: 44% identical to Y325_THEMA: Uncharacterized oxidoreductase TM_0325 (TM_0325) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 96% identity to psa:PST_2593)

MetaCyc: 38% identical to levodione reductase monomer (Leifsonia aquatica)
1.1.1.M48 [EC: 1.1.1.M48]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ7 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psest_1716 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Pseudomonas stutzeri RCH2)
MSMTFSGQVALVTGAAAGIGRATAQAFAEQGLKVVLADIDEAGIRDGAESIRAAGGEAIA
VRCDVTRDAEVKALIEQVLAQFGRLDYAFNNAGIEIEQGRLAEGSEAEFDAIMGVNVKGV
WLCMKHQLPVMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKI
RVNAVCPAVIDTDMFRRAYEADPRKAEFAAAMHPVGRIGKVEEIAAAVLYLCCDGAAFTT
GQALAVDGGATAI