Protein Info for PGA1_c17010 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c-type biogenesis protein CcmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 249 to 265 (17 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 425 to 442 (18 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 492 to 511 (20 residues), see Phobius details amino acids 614 to 633 (20 residues), see Phobius details TIGR00353: cytochrome c-type biogenesis protein CcmF" amino acids 53 to 638 (586 residues), 610.8 bits, see alignment E=1.6e-187 PF01578: Cytochrom_C_asm" amino acids 89 to 296 (208 residues), 177.8 bits, see alignment E=2.5e-56 PF16327: CcmF_C" amino acids 315 to 635 (321 residues), 379.4 bits, see alignment E=1.6e-117

Best Hits

Swiss-Prot: 68% identical to CCMF_RHOCB: Cytochrome c-type biogenesis protein ccl1 (ccl1) from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

KEGG orthology group: K02198, cytochrome c-type biogenesis protein CcmF (inferred from 82% identity to sil:SPO1880)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmF" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX66 at UniProt or InterPro

Protein Sequence (654 amino acids)

>PGA1_c17010 cytochrome c-type biogenesis protein CcmF (Phaeobacter inhibens DSM 17395)
MITELGHFALILAFVITIVQMVVPLVGAHFRWPGWMSVAEPAAQAQFFFTGFAFMALMWA
FITSDFSLRLVALNSHSAKPMLYKISGTWGNHEGSMLLWVLIVSLFGAVASVFGGGLPPT
LKARVLAVQASIGVAFFAFILFTSNPFLRLAVPPFDGQGLNPLLQDPGLAFHPPFLYLGY
VGLSMAFSFAVAALIEGRVDAAWGRWVRPWTLAAWIFLTIGIALGSWWAYYELGWGGFWF
WDPVENASFMPWLLAAALLHSAIVVEKREALKSWTILLAILAFGFSLIGTFIVRSGLLTS
VHAFASDPERGVFILYILAFFTGGALLLFALRAQAMQAKGVFGLVSRETALVANNILLAV
SCFVVFFGTLWPVVAEMAFDRKLSVGPPFFNAAFTPFMVVLGAILPVGAMLPWKRGLLGR
TAWRLRFVFALAVALGVLAWAMQTGRSGLGPIGLFIGVWVVVGAFADLWLRGSATGRWQR
LLRLPRADWGKALAHAGLGVTIFAIAGLTAWQDEDIRIAEVNRPFNVGAYTLELQNVRRV
QGPNYLSTMADIEVTRAGRFVALLNPEKRDYPVSRMPTTEAAIDYRFLRDLYVVIGDQQA
NGGWTVRTYIKPLANWIWGGCLLMSLGGLLSLTDRRFRVAAGARRRPREGVPAE