Protein Info for PGA1_c16900 in Phaeobacter inhibens DSM 17395

Annotation: uracil-DNA glycosylase Ung

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR00628: uracil-DNA glycosylase" amino acids 32 to 209 (178 residues), 201.1 bits, see alignment E=9.8e-64 PF03167: UDG" amino acids 53 to 205 (153 residues), 67.2 bits, see alignment E=8.4e-23

Best Hits

Swiss-Prot: 71% identical to UNG_RUEST: Uracil-DNA glycosylase (ung) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03648, uracil-DNA glycosylase [EC: 3.2.2.-] (inferred from 71% identity to sit:TM1040_1139)

Predicted SEED Role

"Uracil-DNA glycosylase, family 1" in subsystem DNA Repair Base Excision

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQP9 at UniProt or InterPro

Protein Sequence (217 amino acids)

>PGA1_c16900 uracil-DNA glycosylase Ung (Phaeobacter inhibens DSM 17395)
MTPDLSDLGGWSTLPFFAERYPAIAEAVAEDPRDILPPADQRLAALSLTPSEATRVVILG
QDPYPTPGHAHGLAFSVAPDVRPLPRSLNNIFKELHDDLGVERQTGDLRGWARQGVLLLN
TVLSVPAGDANGHKNLGWQQLAHEVLSLTSQRPTAYILWGKQAQGLEKYIQPGDHLILRT
AHPSPLSARRGFFGSRPFSTVNRWLAEQGQPTIDWNA