Protein Info for PGA1_c16890 in Phaeobacter inhibens DSM 17395

Annotation: anthranilate phosphoribosyltransferase TrpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 13 to 334 (322 residues), 367.5 bits, see alignment E=3.4e-114 PF02885: Glycos_trans_3N" amino acids 15 to 67 (53 residues), 66.2 bits, see alignment 1.8e-22 PF00591: Glycos_transf_3" amino acids 76 to 325 (250 residues), 297.1 bits, see alignment E=1.3e-92

Best Hits

Swiss-Prot: 85% identical to TRPD_ROSDO: Anthranilate phosphoribosyltransferase (trpD) from Roseobacter denitrificans (strain ATCC 33942 / OCh 114)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 86% identity to rde:RD1_3210)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZJ5 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c16890 anthranilate phosphoribosyltransferase TrpD (Phaeobacter inhibens DSM 17395)
MSNAMKPLIDAAAERALSREEAEAAFTQLFEGNATPSQMGGLLMALRTRGETVDEYAAAA
AVMRAKCNPVVAPAGAMDIVGTGGDGKGTLNISTATAFVVAGAGTVVAKHGNRNLSSKSG
AADALGQMGINVMVGPKVAEQALREAGICFMMAPMHHPAIAHVMPTRQELGTRTIFNILG
PLTNPAGVKRQLTGAFSRDLIRPMAETLGQLGSEQAWLVHGSDGTDELTITGVSWVAALN
PGGSVTEMEIHPEDAGLSVHPFEAIVGGTPEENAKAFAALLSGEASAYRDAVLLNSAAAL
VVAGAASDLKTGAEMARASIDSGAAREKIEALARITTAAAAT