Protein Info for HP15_166 in Marinobacter adhaerens HP15

Annotation: cation efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 123 to 144 (22 residues), see Phobius details amino acids 150 to 151 (2 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 247 to 270 (24 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 123 to 293 (171 residues), 51.2 bits, see alignment E=6.9e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to maq:Maqu_1294)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJB1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>HP15_166 cation efflux system protein (Marinobacter adhaerens HP15)
MSTPCNGQCGSEDAVVSNEFKSPVTAKIGSQFSTYTVPKMDCPSEERMIRMALTGFDNIQ
SLSFDLSNRKLEIIHQGETGPITSKLETLGLGASLQKSEEASAESVRAAESSKTNESEES
GTLWILLAINALMFLVEMTMGLIAQSAGLIADSLDMLADAAVYGLALYAVGHGIKMQVRA
AHVAGILQLILAAGVLVEVGRRFLFGSDPQSLMMMTVASVALIANISCLLLIAKHREGGA
HMKASWIFSANDVVINLGVILAGLLVAWTGSNYPDLIIGGIVGAIVLMGAKRILALKS