Protein Info for PGA1_c16820 in Phaeobacter inhibens DSM 17395

Annotation: putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 202 (188 residues), 116.4 bits, see alignment E=5.7e-38

Best Hits

KEGG orthology group: None (inferred from 61% identity to rsk:RSKD131_0669)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EMB4 at UniProt or InterPro

Protein Sequence (204 amino acids)

>PGA1_c16820 putative threonine efflux protein (Phaeobacter inhibens DSM 17395)
MTLAAFTASVLLCLMAAISPGPAVLMAARVGLAHGWRSGLALAIGIGAGAVFWASAALFG
LNLLFDYAPFLLTLLKIGGAMFLIYMAWNMWRHASEPMSQDSDAQLPQTAFAAFRLGIFT
QLANPKPAAFFGAVFVGTVPEGSSSLALTALLTCIFLGEVTWNTLVARIFSFEKTRRGYI
NLKHVIDRVFGGLLAALGVKIAAL