Protein Info for PGA1_c16740 in Phaeobacter inhibens DSM 17395

Annotation: diguanylate cyclase domain-containing transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 947 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 47 to 71 (25 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 363 to 388 (26 residues), see Phobius details PF00909: Ammonium_transp" amino acids 7 to 411 (405 residues), 315.4 bits, see alignment E=7.7e-98 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 495 to 653 (159 residues), 102.4 bits, see alignment E=1.1e-33 PF00990: GGDEF" amino acids 497 to 650 (154 residues), 120.6 bits, see alignment E=8.5e-39 PF00563: EAL" amino acids 671 to 904 (234 residues), 207.8 bits, see alignment E=2.5e-65

Best Hits

KEGG orthology group: None (inferred from 65% identity to sit:TM1040_2156)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQN7 at UniProt or InterPro

Protein Sequence (947 amino acids)

>PGA1_c16740 diguanylate cyclase domain-containing transport protein (Phaeobacter inhibens DSM 17395)
MAEFDTAWTVIMALFVLILQCGFLCLESGTVREKNAANVALKNIADICLVGTVFWIAGFG
LMFGSSLGGLVGVDGFFPNLSNVVTGTAGRVPDHAHVGDADHSGGLEAHVSAMFLFQMAF
AATAATIVSGAVAERERFLGYIATSLTLAGLVYPLVGHWVWNPAGWLRQIGFIDFAGATV
VHSVGGWTALIAVLFLGPRLGRYGHKNRFFEENSVSLMALGGMLLWIGWGAFNGGSAMVF
NADVAPVVARTMLSAAGAGVTCIVVGLLVNGHIRAELLINGILGGLVAGTAAIHLVTGPV
AFLIGVAGALTVMFVRDVLDALKIDDVVGAVPVHLAAGVVGTLAVAVAVPYEALPAGSRL
GQLGIQILGVGVVAAWVMATMGPLLWMLNRRGLLRAKPRDEVRGLNLAENNQRNALLDLL
EDMKRHQRSGRFSQRVRVEPSTRLGALAYRYNRVLDRVETEIAQRIDALRRERDMRAIAE
DAFDAMCEAQKESAWAARHDKLTGIGNRKYLEDFLAAPVQVPGEVTLVIALDLDRFKEIN
DTYGHAAGDAVLQVVARRLSGRMQDGRDFAFRIGGDEFTAFVQVSDGGAEAEELCQDLAF
TLLEPFYYQEVRLGFGVSVGFAVMDPGEPLKSTLRRADLALYEAKSSGSDHVVAYSDAIG
QAHSDKMNLIRDFREALERNEITALFQPQIEAKTGRLIGCEVLARWQHPHRGLLTPDVFL
PIAEEMNCSADLDMAILDLALQGYWELHRQGIDLPGISVNVSAARLADPQLIAELQSRDD
IPGGALTFELLETVFLDSISDDYAHKIAMLKDLGISIEIDDFGTGHASIAGVLALQPDRL
KIDRVFASEIDRKPARQDLMRGLIDMAASVGAETVVEGVETWEEASVLTALGADVLQGYV
IGRPMAFEDLLRWHSAREGQADSVAAPGGAPDKTSDRDKDRSLRSTG