Protein Info for HP15_1608 in Marinobacter adhaerens HP15

Annotation: general secretion pathway protein K-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details PF21687: T2SSK_1st" amino acids 113 to 215 (103 residues), 108.3 bits, see alignment E=5.2e-35 PF03934: T2SSK" amino acids 221 to 273 (53 residues), 59 bits, see alignment 7.1e-20

Best Hits

KEGG orthology group: K02460, general secretion pathway protein K (inferred from 77% identity to maq:Maqu_1355)

Predicted SEED Role

"General secretion pathway protein K"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PM44 at UniProt or InterPro

Protein Sequence (334 amino acids)

>HP15_1608 general secretion pathway protein K-like protein (Marinobacter adhaerens HP15)
MGQTPRLSNRQRGVALIMVLLAMALVVMLASGMTQQQSLRVFKAGHYLAQQQGQSIALGA
EAFARQILRRDYDEDKEENLMVDSLDEFWAANAAVLPLDDNGVAEVQIDDLGGRLNLNDL
VGANGQVDPIVRDRFVQLFAALGITAVSVDSLVDWIDPNDQTVTAYGAEDGQYLMAEQGY
RAANQPFTTVTELRLIEGMTEEIYRALRPHVAALPVNGAGINVNTATAMVIRSLHEELTD
AQAASILEKREEERFENLQDFLALPEFAGLGLKSVGLGLQTRFFEVASRITYDNRVVNMV
STVFRTPEGEVQTVNRDIGQKNRITKEPFTISEG