Protein Info for PGA1_c16700 in Phaeobacter inhibens DSM 17395

Annotation: binding protein-dependent transport system, inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 108 to 309 (202 residues), 65.1 bits, see alignment E=3.6e-22

Best Hits

KEGG orthology group: None (inferred from 85% identity to jan:Jann_3554)

Predicted SEED Role

"ABC-type sugar transport systems, permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX38 at UniProt or InterPro

Protein Sequence (316 amino acids)

>PGA1_c16700 binding protein-dependent transport system, inner membrane component (Phaeobacter inhibens DSM 17395)
MAGKAVIARTKTTVVSGGTGARRSLYWQYMVEPFLYLSPMILLIGSVMLIPLIVGISYSF
QSIELLNPFATGWVGFENYEKLWSDRKFWIALENTFFWTFWSIFFQFFLGLGLAMLLNTQ
FFGKKLFQALVFLPWAVPTFLSALTWAWLFNPVIGPIPHWLAALGVLSEPYNILGDPDLA
IWGPITANIWFGVPFFAITLLAALQSIPGELYEAAEIDGATPWQSFTKITLPFLAPMIAI
TVMLRTIWIANFADLIFVMTGGGPANSTQILSTYIFTTAFRKLDFGYASTIAVALLIILL
AYAVILLWMRKRLVKI