Protein Info for Psest_1683 in Pseudomonas stutzeri RCH2

Annotation: MAF protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 TIGR00172: septum formation protein Maf" amino acids 3 to 184 (182 residues), 164.9 bits, see alignment E=7.3e-53 PF02545: Maf" amino acids 4 to 185 (182 residues), 167.6 bits, see alignment E=1.3e-53

Best Hits

Swiss-Prot: 71% identical to NTPPB_PSEAE: 7-methyl-GTP pyrophosphatase (PA2972) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 77% identity to psa:PST_2627)

MetaCyc: 55% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHL1 at UniProt or InterPro

Protein Sequence (192 amino acids)

>Psest_1683 MAF protein (Pseudomonas stutzeri RCH2)
MRHLLLASSSRYRQELLSRLRLPFDSCAPEIDETAFPGETAEHLVRRLAECKAHALSDRY
PDSLIIGSDQVAVLNQEIIGKPHTFERAKQQLLAASGGSVRFLTGLALLDSMNGRLQVAC
VPFTVHFRSLDEARIERYLQTEQPYDCAGSFKAEGLGISLFRTTEGEDVTSLVGLPLIQL
VDMLLNAGVEVP