Protein Info for PGA1_c16690 in Phaeobacter inhibens DSM 17395

Annotation: binding protein-dependent transport system, inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 190 to 214 (25 residues), see Phobius details amino acids 218 to 224 (7 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 97 to 276 (180 residues), 71.9 bits, see alignment E=3e-24

Best Hits

Swiss-Prot: 38% identical to SUGB_MYCTO: Trehalose transport system permease protein SugB (sugB) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 83% identity to jan:Jann_3555)

MetaCyc: 38% identical to ABC-type trehalose transporter integral membrane protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQN4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>PGA1_c16690 binding protein-dependent transport system, inner membrane component (Phaeobacter inhibens DSM 17395)
MGSVARSSSRHPALAFGKYAAIAFYLGFALFPLYWLMKIAITPDALIFSEGTRMLPSAVT
FENFATVLFETEFLAYFRNSLTVSLGTAFFTTLIAAGAGYAFSRFVFAGKRIIIAVMLIT
QMFPLLMIIAPIYKIVADLGLLNSLTSLIVVYTAFNIPFATFLMQSFFDGIPKDLEEAAM
MDGCSRFQALRTVVFPLTLPGLGATLGFVFTAAWSELLFALMLISKNDAMTFPVGLLTFV
SKFSVDWGQMMAAGVLALVPSCLFFIFIQRYLVQGLTSGAVKG