Protein Info for PGA1_c16600 in Phaeobacter inhibens DSM 17395

Annotation: methionine gamma-lyase MdeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 7 to 393 (387 residues), 620.1 bits, E=7.1e-191
• PF01053: Cys_Met_Meta_PP
  • amino acids 10 to 392 (383 residues), 480.2 bits, E=9e-148
• PF00155: Aminotran_1_2
  • amino acids 58 to 194 (137 residues), 35.2 bits, E=2.1e-12
• PF01041: DegT_DnrJ_EryC1
  • amino acids 62 to 188 (127 residues), 25 bits, E=2.7e-09
• PF00266: Aminotran_5
  • amino acids 86 to 230 (145 residues), 33.5 bits, E=6.1e-12

Best Hits

Swiss-Prot: 63% identical to MEGL_PSEPU: L-methionine gamma-lyase (mdeA) from Pseudomonas putida

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 70% identity to sil:SPOA0318)

MetaCyc: 63% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-methionine degradation II (3/3 steps found)
• L-threonine degradation I (5/6 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See I7E0Y9 at UniProt or InterPro

Protein Sequence (401 amino acids)

>PGA1_c16600 methionine gamma-lyase MdeA (Phaeobacter inhibens DSM 17395)
MTKSGSSFSTRAIHHGYDTQSQQGSLNPPLYLTSTFTFDSAEAGGEMFTGEREGHFYSRI
SNPTLDHLEQRIANLEGGEAGLATASGMGAITSTLWSFLAAGDEIILDKTLYGCTFSFMT
HGLPRFGVKVRLVDMTDPTNLAEAISPKTKLVYFETPANPNNRLIDIAAISEIAHKAGAK
VVVDNTFATPVLTRPIELGADIVVHSATKFISGHGDVIAGLVVGSKEEITQIRLVGLKDM
TGAVMSPFSAMLLMRGLKTLELRMERHCKSALKVAEALQAHPAVERVYYPGLDDFAQGDL
ARRQMSGFGGMIPFEVVGGKAGGIAMMNRLAMIQRAVSLGDAETLIQHPASMTHSTYTPE
ERAEHGIAEGLVRMSVGLEGVDDIIDDLMQALSSHNAYAAA