Protein Info for Psest_1674 in Pseudomonas stutzeri RCH2

Annotation: tetraacyldisaccharide 4'-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 19 to 325 (307 residues), 357 bits, E=4.7e-111
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 26 to 313 (288 residues), 257.2 bits, E=1e-80

Best Hits

Swiss-Prot: 85% identical to LPXK_PSEU5: Tetraacyldisaccharide 4'-kinase (lpxK) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 85% identity to psa:PST_2636)

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (14/17 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)
• superpathway of Kdo₂-lipid A biosynthesis (17/25 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See L0GLL9 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Psest_1674 tetraacyldisaccharide 4'-kinase (Pseudomonas stutzeri RCH2)
MSFADRLQRAWYQGHPALRLLAPLELLYRRVVEAKRRRFLKGESATYRAPVPVVVVGNIT
VGGTGKTPLILWLIEHCRSRGLRVGVVSRGYGATPPSLPWRVRAEDSAQEAGDEPLLIVQ
RTGVPLVIDPDRSRAIRRLLEAEPLDLILSDDGLQHYRLARDLELVLIDAARGLGNGRCL
PAGPLREPAERLESVDAVLLNGAKADSTAGYGFSLQPVALVELISDERWSLDHFPAGQQL
HAVAGIGNPQRFFTTLETLHWRPIPHAFSDHAAYSSEQLKFSPDLPLVMTEKDAVKCRAF
APPGWSYLQVQAVPSAAFVTWFDGQLTRLLPDHT