Protein Info for Psest_1671 in Pseudomonas stutzeri RCH2

Annotation: DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 283 to 299 (17 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details amino acids 442 to 463 (22 residues), see Phobius details amino acids 470 to 479 (10 residues), see Phobius details PF13567: DUF4131" amino acids 21 to 168 (148 residues), 118.2 bits, see alignment E=4.6e-38 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 111 to 716 (606 residues), 340 bits, see alignment E=2.4e-105 PF03772: Competence" amino acids 201 to 464 (264 residues), 182.2 bits, see alignment E=2e-57 TIGR00360: ComEC/Rec2-related protein" amino acids 222 to 397 (176 residues), 87.1 bits, see alignment E=1.7e-28 PF00753: Lactamase_B" amino acids 500 to 684 (185 residues), 57.3 bits, see alignment E=3.3e-19

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 79% identity to psa:PST_2639)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJN6 at UniProt or InterPro

Protein Sequence (741 amino acids)

>Psest_1671 DNA internalization-related competence protein ComEC/Rec2 (Pseudomonas stutzeri RCH2)
MRTWMLALAAGLVLPRFLPALPASWICAAFAAVGALMLMRRSWVPFGLFLLGLGWACYQS
QNALADRLPVAMDGRTFWIEGRVVDLPAAIGDVVRFELADIESRHVGLPSKVRLSWYGGP
QLRAGERWRLAVRLKRPRGLVNPQSFDYEAWLLARGIGATGTVKAGERLSASVATDGWRD
RLRARLMAVPAFDRQGAIAALVVGDDSGLRRSDWQVLQDTGTVHLMVISGQHIGMLAGLL
YGLVALLARLGVWPRPWPWLPCACGLALAGALSYGWLAGFDVPVRRACFMVAVVLLWRLR
FRHLGVWQPLLLALNGVLLIDPLVTLQPGFWLSFGAVAVLALAFAGRLGRWIWWKTLLRA
QWAATLGLLPLLLALGLPVSASSPLANLIAVPWVSLTVPFALLGTILLPLGGVGEAILWL
VGGSLALLFELLGLIASWRPAWFAVGLPCWVFLMIALGVLLLLMPAGIPLRALGVMLLLP
LAFPPRMEVPEGRAQVWVLDVGQGLSVLVRTREHALLYDAGPRQGDFDAGERVVFPSIRS
LAVSRLDMLLLSHADNDHSGGAQAVQHLMPVARIISGEPQRHADGLNAEPCESGAQWQWN
GVRFTLWQWQAARESNQLSCVLLVEANGERLLLTGDIDQAAEQALLRSGTEVQAQWLLLP
HHGSRSSSSESFLRAVEPTTALISRSFHNAFGHPHPSVTTRLAALGVGTYDTALHGAIRI
DLGDFSAAEARRAGRRFWREK