Protein Info for PGA1_c16540 in Phaeobacter inhibens DSM 17395

Annotation: putative branched-chain amino acid transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 260 to 285 (26 residues), see Phobius details amino acids 297 to 319 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 30 to 307 (278 residues), 125.8 bits, see alignment E=8.8e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to sit:TM1040_2235)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EM97 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PGA1_c16540 putative branched-chain amino acid transport system, permease component (Phaeobacter inhibens DSM 17395)
MNREKLLNAAVILLLLAIPLWAHMTEEPFLITLATKVAILALAGVGLNIALGIGGLVSLG
HAAFFGIGGYAMGILAAHAQNYEPLAEWPLLIEGTNQMPVIWLVAVVASALAALVIGALS
LRTSGVYFIMITLAFGQMLYYFAISWSAYGGEDGLSIWVRNEFPGMNTLAPLQFFLICYA
ILCAALWFAARLARAPFGLALSAARQCEARVETVGITPYQLRLTAFVISGAITGLAGALF
ADLNRFVSPTMLSWHTSGEIMIFVIIGGVGRLFGPVIGAALFILLEHLLGGISDYWQIYL
GGLLLIIVLYARGGVIGAISGREVAHD