Protein Info for HP15_163 in Marinobacter adhaerens HP15

Annotation: cation efflux family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 19 to 292 (274 residues), 268.4 bits, see alignment E=3.6e-84 PF01545: Cation_efflux" amino acids 23 to 208 (186 residues), 140 bits, see alignment E=4.3e-45

Best Hits

Swiss-Prot: 34% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 57% identity to mxa:MXAN_5264)

MetaCyc: 35% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJA8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>HP15_163 cation efflux family protein (Marinobacter adhaerens HP15)
MHDHSHGHDHSHHFDTHNRSFAIAVFLNILFVVIEAVYGVISGSLALLADAGHNLSDVMG
LIMAWAASWLASKAATNAKTYGLKKTTILAALFNALILIAAVGGITWEALQRLTDPADVA
GLTVVIVAGIGVLINGATMMLFLKGQKGDINIRGAFLHMAADTAVSVGVVISGTILMFTN
LTWIDPIVSLVIAVVIFVGTWQLLKDSVNLAVDAVPKGIDPSAVHERLERLPGVISAHHL
HIWALSTTENALTVHLVKPDPESDDQVISEAAEMLNQHFGIQHTTVQWERCEGQCPNTLL
C