Protein Info for Psest_1664 in Pseudomonas stutzeri RCH2

Annotation: Glycerophosphoryl diester phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 PF03009: GDPD" amino acids 7 to 231 (225 residues), 127.3 bits, see alignment E=1.1e-40 PF13653: GDPD_2" amino acids 202 to 230 (29 residues), 31.7 bits, see alignment (E = 1.7e-11)

Best Hits

KEGG orthology group: K01126, glycerophosphoryl diester phosphodiesterase [EC: 3.1.4.46] (inferred from 92% identity to psa:PST_2646)

Predicted SEED Role

"Glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 3.1.4.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.4.46

Use Curated BLAST to search for 3.1.4.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLL0 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Psest_1664 Glycerophosphoryl diester phosphodiesterase (Pseudomonas stutzeri RCH2)
MTLIYGHRGAKGEAPENTLVSFQQCLQHGVRRCELDLHLSQDGELLVIHDPTLKRTTGRR
GKVAQHDAEELVNYDARLGGPGWKVPCPIPRLSELFEKCDFEHWQLEVKSASRVRAARTV
MAIKELAARHGLLDRITVTSSSREVLRALNRLAPEISRGLVAEYSWLDPLKVARQYGCEL
LALKWTLCTPERLEKARKQGLHVSVWTVNEPALMRRLADFGVDSLITDYPGLAVSTLARS