Protein Info for PGA1_c16490 in Phaeobacter inhibens DSM 17395

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details PF13505: OMP_b-brl" amino acids 40 to 198 (159 residues), 43.6 bits, see alignment E=3.8e-15 PF13609: Porin_4" amino acids 53 to 194 (142 residues), 31.8 bits, see alignment E=1.3e-11

Best Hits

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EM94 at UniProt or InterPro

Protein Sequence (198 amino acids)

>PGA1_c16490 hypothetical protein (Phaeobacter inhibens DSM 17395)
MTPAFIRSTDHDLSAHRKQRRRWLRTGGSGSARWAAIARLTAAVLAAAPCSAGDWSGFFL
GASMARVQAAQSVRGSVSASGLHLGYDHDFGLVVLGGEVEVDRSGRARSDLTEDQTRRIK
LRAGYDMGETLGYVTVGSARNETATDSDNGAVYGLGLSYSLNRALRVSGEYLHQDASDGA
AVQTPSRDILSIRASFQF