Protein Info for PGA1_c16420 in Phaeobacter inhibens DSM 17395

Annotation: putative phospholipase / carboxylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 PF02230: Abhydrolase_2" amino acids 16 to 216 (201 residues), 122.7 bits, see alignment E=7.3e-39 PF00561: Abhydrolase_1" amino acids 20 to 147 (128 residues), 29.9 bits, see alignment E=1.5e-10 PF12697: Abhydrolase_6" amino acids 21 to 141 (121 residues), 27.5 bits, see alignment E=1.7e-09 PF03959: FSH1" amino acids 22 to 194 (173 residues), 30.2 bits, see alignment E=1.3e-10 PF01738: DLH" amino acids 86 to 204 (119 residues), 37.5 bits, see alignment E=6.9e-13 PF00326: Peptidase_S9" amino acids 153 to 205 (53 residues), 26 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: K06999, (no description) (inferred from 89% identity to sit:TM1040_1158)

Predicted SEED Role

"Phospholipase/carboxylesterase family protein (EC 3.1.-.-)" (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DQL4 at UniProt or InterPro

Protein Sequence (221 amino acids)

>PGA1_c16420 putative phospholipase / carboxylesterase (Phaeobacter inhibens DSM 17395)
MTRVLSAERRAPLSGQTRSVVVFLHGYGANGADLLGLADPLGEHLPDTLFVAPDAPERCA
GTPFGFQWFPIPWIDGSSEEESMRGMMASIEDLNAFLDALMVDEDVLPEQVVLFGFSQGT
MMSLHVAPRREDAVAGIVAFSGRLLSPETLKDEVVSKMPVLLVHGDADDVVPPQSLPEAA
EALGEAGFQDVFAHIMKGTGHGIAPDGLSVALAFMRDKLSL