Protein Info for Psest_1656 in Pseudomonas stutzeri RCH2

Annotation: NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 56 to 75 (20 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 195 to 211 (17 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details amino acids 347 to 365 (19 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details TIGR01937: NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit" amino acids 4 to 398 (395 residues), 615.1 bits, see alignment E=2.9e-189 PF03116: NQR2_RnfD_RnfE" amino acids 41 to 395 (355 residues), 348.2 bits, see alignment E=2.1e-108

Best Hits

Swiss-Prot: 98% identical to NQRB_PSEU5: Na(+)-translocating NADH-quinone reductase subunit B (nqrB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00347, Na+-transporting NADH:ubiquinone oxidoreductase subunit B [EC: 1.6.5.-] (inferred from 98% identity to psa:PST_2654)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit B (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJM2 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psest_1656 NADH:ubiquinone oxidoreductase, Na(+)-translocating, B subunit (Pseudomonas stutzeri RCH2)
MGIRAFLDKIEHHFEKGGKYEKWYALYEAADTFLYRPGSVTKTTAHVRDGIDLKRMMITV
WMCTFPAMFFGMWNTGYQANLIFAQSPDVLAAQEGWRFGLIGALAGFDPNSLWDNFIQGA
AYFLPIYAVTFIVGGFWEVLFASIRKHEVNEGFFVTSVLFALILPPTIPLWQVALGISFG
VVIGKEIFGGTGKNFLNPALTARAFLFFAYPAQMSGDAVWTAVDGYAGATALSLGFAGGI
ENVIESGITWMDAFVGTIHGSIGETSTLAIFIGGVILIGSKIASWRIVTGVMLGMIGLST
LFNLIGSETNPLFGMPWYWHMVVGGFAFGMIFMATDPVSASMTNTGKWVFGILIGVMVVL
IRVVNPAFPEGMMLAILFANLCAPLIDHFVIQANIKRRLARNV