Protein Info for PGA1_c16390 in Phaeobacter inhibens DSM 17395

Annotation: ornithine cyclodeaminase ArcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to OCD_BRUSU: Ornithine cyclodeaminase (ocd) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 91% identity to sit:TM1040_1163)

MetaCyc: 67% identical to ornithine cyclodeaminase (Agrobacterium tumefaciens)
Ornithine cyclodeaminase. [EC: 4.3.1.12]

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

L-arginine degradation VII (arginase 3 pathway) (2/2 steps found)
L-ornithine degradation I (L-proline biosynthesis) (1/1 steps found)
L-proline biosynthesis II (from arginine) (1/2 steps found)

KEGG Metabolic Maps

Arginine and proline metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EM85 at UniProt or InterPro

Protein Sequence (348 amino acids)

>PGA1_c16390 ornithine cyclodeaminase ArcB (Phaeobacter inhibens DSM 17395)
MTQPSDKALVPFVSVDNMMRLIHHVGIDTVMKDLATYIEEDFKRWELFDKTPRVASHSDV
GVIELMPTSDGEAYGFKYVNGHPKNTSEGLQTVTAFGLLADVYTGYPVLLTEMTILTALR
TAATSAMVAKHLAPKGATTMAMIGNGAQSEFQSLAMQAICGLKSVRLYDVDPAATAKCAA
NLAGTGLAVVSCKTPEEAIEGAQILTTCTADKQYATILTDNMVGSGVHINAIGGDCPGKT
ELAPGILSRSDVFVEFPPQTRVEGEIQQMPEDFEVTELWQVILGQKPGRRDDKQITLFDS
VGFAIEDFSALRYIRDRIKDTDFFLELDMLADPDDPRDLFGMVQRAKG