Protein Info for Psest_1649 in Pseudomonas stutzeri RCH2

Annotation: Predicted exonuclease of the beta-lactamase fold involved in RNA processing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR04122: putative exonuclease, DNA ligase-associated" amino acids 4 to 329 (326 residues), 493 bits, see alignment E=1.6e-152

Best Hits

KEGG orthology group: K07577, putative mRNA 3-end processing factor (inferred from 97% identity to psa:PST_2661)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLJ4 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psest_1649 Predicted exonuclease of the beta-lactamase fold involved in RNA processing (Pseudomonas stutzeri RCH2)
MDLVVARPEGLYCPPGDFYIDPWRPVERAVITHAHGDHARWGMSHYLASSDSEGILRSRI
AADMPLQTLAYGESIEHHGVKLSFHPAGHVLGSAQVRLEYKGEVWVASGDYKVEPDGTCA
PFEPVRCHTFITESTFGLPIYKWPSQAEVFSDINDWWRANAAAGRASVLFCYAFGKAQRI
LHGLDESIGTIVVHGAVEPLNKVYREGGIYLPPTVYAGDLKKGDPRLKHAIILAPPSAGG
STWMRRFGDYADAFASGWMMLRGTRRRRGVDRGFVLSDHADWPGLLWAIEQTGAERVMVT
HGSVAVLVRYLREMRGLDAQAFATEYGEEDDATQEAE