Protein Info for Psest_1641 in Pseudomonas stutzeri RCH2

Annotation: MazG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 TIGR00444: MazG family protein" amino acids 10 to 267 (258 residues), 324.9 bits, see alignment E=1.8e-101 PF03819: MazG" amino acids 27 to 100 (74 residues), 92.7 bits, see alignment E=1.4e-30 amino acids 180 to 236 (57 residues), 47 bits, see alignment E=2.5e-16 PF01503: PRA-PH" amino acids 163 to 227 (65 residues), 36.9 bits, see alignment E=3.8e-13

Best Hits

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 84% identity to pmy:Pmen_1736)

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJL2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Psest_1641 MazG family protein (Pseudomonas stutzeri RCH2)
MYQLPDLLHLMARLRDPQHGCPWDLQQNYASIVPHTLEEAYEVADAIESGDFDHLPGELG
DLLFQVVYYSQLAREEGRFEFATVVDAITRKLIRRHPHVFPDGDLYGSPELPRLDEAAIK
QRWEEIKAEERAEKAAAPEQLSLLDDVPSALPALSRAAKLQKRAAQVGFDWPEALPVVDK
VREELGEVLEAMSEDDPQAIAEELGDLLFVVVNLARHLKVDPENALRAANGKFERRFRFI
EQALREAGRPIEHCDLDELDALWGEAKKAEQSPSCG