Protein Info for Psest_1639 in Pseudomonas stutzeri RCH2

Annotation: 23S rRNA (uracil-5-)-methyltransferase RumA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01938: TRAM
  • amino acids 23 to 75 (53 residues), 41.8 bits, 3.2e-14
• TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA
  • amino acids 271 to 442 (172 residues), 202.9 bits, E=4.3e-64
• PF05958: tRNA_U5-meth_tr
  • amino acids 279 to 449 (171 residues), 83.6 bits, E=5.7e-27
• PF03602: Cons_hypoth95
  • amino acids 289 to 407 (119 residues), 28 bits, E=6.6e-10
• PF01135: PCMT
  • amino acids 291 to 360 (70 residues), 20.3 bits, E=1.6e-07
• PF05175: MTS
  • amino acids 297 to 383 (87 residues), 24.5 bits, E=7.6e-09
• PF13847: Methyltransf_31
  • amino acids 304 to 381 (78 residues), 41.4 bits, E=4.6e-14
• PF13649: Methyltransf_25
  • amino acids 308 to 363 (56 residues), 36.5 bits, 2.5e-12
• PF08241: Methyltransf_11
  • amino acids 309 to 367 (59 residues), 27.8 bits, E=1.3e-09

Best Hits

Swiss-Prot: 69% identical to RLMD_PSEPK: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 82% identity to psa:PST_2670)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See L0GLI4 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Psest_1639 23S rRNA (uracil-5-)-methyltransferase RumA (Pseudomonas stutzeri RCH2)
MAKRSGALRFQPSGGERKPQVPIGKKQRLNIERLANDGRGIAFVEGRTWFVEGALPGEEV
EARVLSARSQVVEARCERVLQASAQRQVEPCPHARLCGGCNLQHAPIADQLALKQHTLAE
QLARVADLQPEAWAEPLVGPAFGYRRRARLAVRWDVKSKHLDIGFRASSSQEIVSIRECP
VLVQPLQTLLPGLLTALRDLSKPQAIGHVELFSGTAEAVLIRHTAALPESDLARLRSFAT
AHRAQLWWQGEGEPQPDDCAASLGYRLDAWDLELAWRPGDFVQVNAPVNDAMVAQALEWL
DAGKDEAVLDLFCGLGNFSLPLARSGARVVGVEGVEAMVARAQENAQRNALEHAHFYRAD
LSKPLADAPWAGSGFAAVLLDPPRDGALEIVRQMSMLKAQRVVYVSCNPATLARDARELA
SQGYRLKRAGVLDMFPQTAHVEAMALFERG