Protein Info for Psest_1638 in Pseudomonas stutzeri RCH2

Annotation: cysteine synthase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 90% identical to CYSM_PSEAE: Cysteine synthase B (cysM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12339, cysteine synthase B [EC: 2.5.1.47] (inferred from 96% identity to psa:PST_2671)

MetaCyc: 70% identical to cysteine synthase B (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]; Cysteine synthase. [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47]; SULFOCYS-RXN [EC: 4.4.1.1, 4.4.1.28, 2.5.1.47, 2.5.1.144]

Predicted SEED Role

"Cysteine synthase B (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of branched chain amino acid biosynthesis (17/17 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
L-serine degradation (3/3 steps found)
L-methionine biosynthesis II (5/6 steps found)
L-threonine degradation I (5/6 steps found)
L-cysteine biosynthesis I (2/2 steps found)
L-cysteine biosynthesis VII (from S-sulfo-L-cysteine) (3/4 steps found)
superpathway of L-threonine metabolism (13/18 steps found)
D-serine degradation (2/3 steps found)
L-cysteine degradation II (2/3 steps found)
L-methionine degradation II (2/3 steps found)
L-tryptophan degradation II (via pyruvate) (2/3 steps found)
superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
glycine betaine degradation III (4/7 steps found)
purine nucleobases degradation II (anaerobic) (16/24 steps found)
superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
superpathway of L-cysteine biosynthesis (mammalian) (2/5 steps found)
L-mimosine degradation (4/8 steps found)
glycine betaine degradation I (4/8 steps found)
homocysteine and cysteine interconversion (1/4 steps found)
glutathione-mediated detoxification I (3/8 steps found)
L-cysteine biosynthesis VI (reverse transsulfuration) (2/7 steps found)
hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
hypoglycin biosynthesis (4/14 steps found)
superpathway of L-methionine salvage and degradation (5/16 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.144 or 2.5.1.47 or 4.4.1.1 or 4.4.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHH6 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Psest_1638 cysteine synthase B (Pseudomonas stutzeri RCH2)
MTTHYPTIADCIGNTPLVRLQRMPGKTSNTILVKLEGNNPAGSVKDRPALSMINRAELRG
DIQPGDTLIEATSGNTGIALAMAAAIKGYRMILIMPDNSTAERKAAMTAYGAELILVSKE
EGMEGARDLALKMQAEGRGKVLDQFANGDNPEAHYNSTGPELWRQTHGSITHFISSMGTT
GTIMGVSRYLKEQNPAVQIVGLQPMEGAAIPGIRRWPQEYLPKIYQAERVDRVVDMSQAE
AEQVMRRLAREEGIFCGVSSGGAVAAALRLSQEVENAVIVAIICDRGDRYLSTGVYDSPN